BRI3 Polyclonal antibody

• 

  IHC staining of human brain using 14591-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14591-1-AP (BRI3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 14591-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14591-1-AP (BRI3 antibody) at dilution of 1:50 (under 40x lens).

BRI3 Polyclonal Antibody for ELISA

Cat No. 14591-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

brain protein I3, BRI3, I3, pRGR2

---

Product Information

14591-1-AP targets BRI3 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6123

  Product name: Recombinant human BRI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC018737

  Sequence: MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA

• Full Name: brain protein I3
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: BC018737
• Gene Symbol: BRI3
• Gene ID (NCBI): 25798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95415
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.