BRINP1 Monoclonal antibody, PBS Only

• 

  WB analysis of fetal human brain using 60336-1-Ig (same clone as 60336-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 60336-1-Ig (DBC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60336-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 60336-1-Ig (same clone as 60336-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 60336-1-Ig (DBC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60336-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 60336-1-Ig (same clone as 60336-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 60336-1-Ig (DBC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60336-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 60336-1-Ig (same clone as 60336-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed MCF-7 cells using 60336-1-Ig(DBC1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60336-1-PBS in a different storage buffer formulation.

BRINP1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 60336-1-PBS

Clone No.2A10E3

Host / Isotype

Mouse / IgG2c

Reactivity

human, pig, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

BRINP1, DBC1, DBCCR1, deleted in bladder cancer 1, FAM5A, Protein FAM5A

---

Product Information

60336-1-PBS targets BRINP1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig, mouse samples.

• Tested Reactivity: human, pig, mouse
• Host / Isotype: Mouse / IgG2c
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6588

  Product name: Recombinant human DBC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-306 aa of BC021560

  Sequence: MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVERHRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPITDIQIMEYTLANMAKSWAEAYKDLEN

• Full Name: deleted in bladder cancer 1
• Calculated Molecular Weight: 761 aa, 88 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC021560
• Gene Symbol: BRINP1
• Gene ID (NCBI): 1620
• RRID: AB_2881445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60477
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BRINP1, also known as DBC1 and FAM5A, inhibits cell proliferation by negative regulation of the G1/S transition. It mediates cell death which is not of the classical apoptotic type and regulates expression of components of the plasminogen pathway.