BRSK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BRSK1 Polyclonal antibody, PBS Only (12673-1-PBS)

• 

  WB analysis using 12673-1-AP (same clone as 12673-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12673-1-AP (BRSK1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12673-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12673-1-AP (same clone as 12673-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12673-1-AP (BRSK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12673-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12673-1-AP (same clone as 12673-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12673-1-AP (BRSK1 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12673-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 12673-1-AP (same clone as 12673-1-PBS)

  IP result of anti-BRSK1 (IP:12673-1-AP, 4ug; Detection:12673-1-AP 1:500) with mouse brain tissue lysate 3440ug. This data was developed using the same antibody clone with 12673-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 12673-1-AP (same clone as 12673-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 12673-1-AP (BRSK1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12673-1-PBS in a different storage buffer formulation.

BRSK1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12673-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12673-1-PBS targets BRSK1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3357

  Product name: Recombinant human BRSK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 475-778 aa of BC016681

  Sequence: TQTLPSRGPRGGGAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRAPPKDKKLLATNGTPLP

• Full Name: BR serine/threonine kinase 1
• Calculated Molecular Weight: 87 kDa
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC016681
• Gene Symbol: BRSK1
• Gene ID (NCBI): 84446
• RRID: AB_2274933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDC3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BRSK1(Brain-specific serine/threonine-protein kinase 1) is also named as KIAA1811, SAD1, SADB and belongs to the SNF1 subfamily. BRSKs are crucial for establishing neuronal polarity, and BRSK1 has also been shown to regulate neurotransmitter release presynaptically. BRSK1 is a serine-threonine kinases specifically expressed in the brain, and activated by LKB1-mediated phosphorylation of a threonine residue at their T-loop. (PMID:22020259). It has 3 isoforms produced by alternative splicing.