BRSK1 Recombinant monoclonal antibody, PBS Only (Detector)

BRSK1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 86462-1-PBS
Clone No.251341A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

BR serine/threonine kinase 1, BR serine/threonine-protein kinase 1, Brain-selective kinase 1, Brain-specific serine/threonine-protein kinase 1, EC:2.7.11.1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86462-1-PBS targets BRSK1 as part of a matched antibody pair:

MP02463-1: 86462-2-PBS capture and 86462-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3357

Product name: Recombinant human BRSK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 475-778 aa of BC016681

Sequence: TQTLPSRGPRGGGAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRAPPKDKKLLATNGTPLP

Predict reactive species
Full Name BR serine/threonine kinase 1
Calculated Molecular Weight 87 kDa
Observed Molecular Weight 85-90 kDa
GenBank Accession NumberBC016681
Gene Symbol BRSK1
Gene ID (NCBI) 84446
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TDC3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BRSK1(Brain-specific serine/threonine-protein kinase 1) is also named as KIAA1811, SAD1, SADB and belongs to the SNF1 subfamily. BRSKs are crucial for establishing neuronal polarity, and BRSK1 has also been shown to regulate neurotransmitter release presynaptically. BRSK1 is a serine-threonine kinases specifically expressed in the brain, and activated by LKB1-mediated phosphorylation of a threonine residue at their T-loop. (PMID:22020259). It has 3 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...