BRWD3 Polyclonal antibody

• 

  WB analysis using 31795-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31795-1-AP (BRWD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

BRWD3 Polyclonal Antibody for WB, ELISA

Cat No. 31795-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Bromodomain and WD repeat-containing protein 3

---

Tested Applications

• Positive WB detected in: COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31795-1-AP targets BRWD3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36948

  Product name: Recombinant human BRWD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1720-1802 aa of BC039508

  Sequence: ATRAKRARIADDEFDTMFSGRFSRLPRIKTRNQGRRTVLYNDDSDNDNFVSTEDPLNLGTSRSGRVRKMTEKARVSHLMGWNY

• Full Name: bromodomain and WD repeat domain containing 3
• Calculated Molecular Weight: 204 kDa
• Observed Molecular Weight: 240 kDa
• GenBank Accession Number: BC039508
• Gene Symbol: BRWD3
• Gene ID (NCBI): 254065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6RI45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Bromodomain and WD repeat-containing protein 3 (BRWD3) is thought to regulate gene expression through its interactions with chromatin. BRWD3 promotes the K48-linked polyubiquitination and degradation of KDM5, which depends on BRWD3 and Cul4. This function is critical for maintaining H3K4 methylation levels and regulating gene expression (PMID: 37722046). Mutations of BRWD3 are associated with a spectrum of cognitive disabilities and X-linked macrocephaly (PMID: 17668385).