• Featured Product
  • KD/KO Validated

CD157 Polyclonal antibody

CD157 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 16337-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

ADP ribosyl cyclase 2, ADP-ribosyl cyclase 2, ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, Bone marrow stromal antigen 1, BST 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, RAW 264.7 cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

16337-1-AP targets CD157 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityrat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9491

Product name: Recombinant human BST1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 40-318 aa of BC012095

Sequence: SAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL

Predict reactive species
Full Name bone marrow stromal cell antigen 1
Calculated Molecular Weight 318 aa, 36 kDa
Observed Molecular Weight 39-46 kDa
GenBank Accession NumberBC012095
Gene Symbol CD157
Gene ID (NCBI) 683
RRIDAB_2878244
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ10588
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BST-1(bone marrow stromal cell antigen 1), also named as CD157 or ADP-ribosyl cyclase 2, is a glycosyl phosphotidylinositol-anchored protein that stimulates pre-B-cell growth and has adenosine diphosphate (ADP)-ribosyl cyclase and cyclic ADP-ribose (cADPR) hydrolase activity (PMID: 9473467, 11866528). The two enzymatic activities are responsible for the synthesis and hydrolysis of cADPR, a novel second messenger of calcium release from intracellular calcium stores. BST-1 has a calculated molecular mass of 30-36 kDa and an apparent molecular mass of 40-46 kDa due to the glycosylation (PMID: 8941363, 10491089).

Protocols

Product Specific Protocols
IHC protocol for CD157 antibody 16337-1-APDownload protocol
WB protocol for CD157 antibody 16337-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

EMBO J

Control of NAD+ homeostasis by autophagic flux modulates mitochondrial and cardiac function

Authors - Quanjiang Zhang
Loading...
||
New chat Able
正在加载,请稍候...