CD157 Polyclonal antibody

• 

  WB analysis of RAW 264.7 using 16337-1-AP

  WB result of CD157 antibody (16337-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD157 transfected RAW 264.7 cells.

• 

  WB analysis of A549 using 16337-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 16337-1-AP (CD157 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 16337-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16337-1-AP (CD157 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16337-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16337-1-AP (CD157 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CD157 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16337-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

ADP ribosyl cyclase 2, ADP-ribosyl cyclase 2, ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, Bone marrow stromal antigen 1, BST 1

---

Tested Applications

• Positive WB detected in: A549 cells, RAW 264.7 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

16337-1-AP targets CD157 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9491

  Product name: Recombinant human BST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-318 aa of BC012095

  Sequence: SAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL

• Full Name: bone marrow stromal cell antigen 1
• Calculated Molecular Weight: 318 aa, 36 kDa
• Observed Molecular Weight: 39-46 kDa
• GenBank Accession Number: BC012095
• Gene Symbol: CD157
• Gene ID (NCBI): 683
• RRID: AB_2878244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q10588
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BST-1(bone marrow stromal cell antigen 1), also named as CD157 or ADP-ribosyl cyclase 2, is a glycosyl phosphotidylinositol-anchored protein that stimulates pre-B-cell growth and has adenosine diphosphate (ADP)-ribosyl cyclase and cyclic ADP-ribose (cADPR) hydrolase activity (PMID: 9473467, 11866528). The two enzymatic activities are responsible for the synthesis and hydrolysis of cADPR, a novel second messenger of calcium release from intracellular calcium stores. BST-1 has a calculated molecular mass of 30-36 kDa and an apparent molecular mass of 40-46 kDa due to the glycosylation (PMID: 8941363, 10491089).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	EMBO J; Control of NAD+ homeostasis by autophagic flux modulates mitochondrial and cardiac function; Authors - Quanjiang Zhang