BST2 Recombinant monoclonal antibody, PBS Only

• 

BST2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84190-1-PBS

Clone No.241513C1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CD317, Bone marrow stromal antigen 2, BST 2, BST-2, CD 317

---

Product Information

84190-1-PBS targets BST2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1961

  Product name: Recombinant Human BST2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 49-161 aa of BC033873

  Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS

• Full Name: bone marrow stromal cell antigen 2
• Calculated Molecular Weight: 180 aa, 20 kDa
• GenBank Accession Number: BC033873
• Gene Symbol: BST2
• Gene ID (NCBI): 684
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q10589
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.