Anti-Human BST2 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human BST2 Rabbit Recombinant Antibody, PBS Only (98305-2-PBS)

BST2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98305-2-PBS

Clone No.250317H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD317, Bone marrow stromal antigen 2, BST 2, BST-2, CD 317

• 

  FC experiment of human PBMCs using 98305-2-RR (same clone as 98305-2-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human BST2 Rabbit RecAb (98305-2-RR, Clone: 250317H5) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD14. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98305-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98305-2-RR (same clone as 98305-2-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human BST2 Rabbit RecAb (98305-2-RR, Clone: 250317H5) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98305-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

98305-2-PBS targets BST2 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1961

  Product name: Recombinant Human BST2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 49-161 aa of BC033873

  Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS

• Full Name: bone marrow stromal cell antigen 2
• Calculated Molecular Weight: 180 aa, 20 kDa
• GenBank Accession Number: BC033873
• Gene Symbol: BST2
• Gene ID (NCBI): 684
• RRID: AB_3745965
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q10589
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BST2, also named as CD317 and Tetherin, belongs to the tetherin family. It may be involved in the sorting of secreted proteins and it is involved in pre-B-cell growth. BST2 is an antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. BST2 may play a role in B-cell activation in rheumatoid arthritis. It is recently identified interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. BST2 is a plasma membrane proteins, tetherin inhibits virion particle release from infected cells. BST2 is effective against retroviruses and flavoviruses whilst IFITMs disrupt influenza and flavivirus infection.