Tested Applications
Positive WB detected in | A549 cells, MDA-MB-231 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-66683 targets Betacellulin in WB applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26724 Product name: Recombinant human BTC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-118 aa of BC011618 Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ Predict reactive species |
Full Name | betacellulin |
Calculated Molecular Weight | 20 kDa |
Observed Molecular Weight | 20 kDa |
GenBank Accession Number | BC011618 |
Gene Symbol | BTC |
Gene ID (NCBI) | 685 |
RRID | AB_3672921 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P35070 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CL Plus 488 Betacellulin antibody CL488-66683 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |