CoraLite® Plus 488-conjugated Betacellulin Monoclonal antibody

• 

  WB analysis using CL488-66683

  Various lysates were subjected to SDS PAGE followed by western blot with CL488-66683 (BTC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Betacellulin Monoclonal Antibody for WB

Cat No. CL488-66683

Clone No.2H5E8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB

Synonyms

BTC, Probetacellulin, 2H5E8

---

Tested Applications

• Positive WB detected in: A549 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66683 targets Betacellulin in WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26724

  Product name: Recombinant human BTC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-118 aa of BC011618

  Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ

• Full Name: betacellulin
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC011618
• Gene Symbol: BTC
• Gene ID (NCBI): 685
• RRID: AB_3672921
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P35070
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Betacellulin (BTC), a member of the epidermal growth factor (EGF) family, binds and activates ErbB1 and ErbB4 homodimers. BTC is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. BTC was expressed in tumors and involved in tumor growth progression.