Product Information
83040-1-PBS targets Betacellulin in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Affinity | KD=7.18 x 10-10M KOff=2.28 x 10-4M KOn=3.17 x 105M |
| Immunogen |
CatNo: Ag26724 Product name: Recombinant human BTC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-118 aa of BC011618 Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ Predict reactive species |
| Full Name | betacellulin |
| Calculated Molecular Weight | 20 kDa |
| GenBank Accession Number | BC011618 |
| Gene Symbol | BTC |
| Gene ID (NCBI) | 685 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35070 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
