Betacellulin Recombinant monoclonal antibody, PBS Only (Capture)

Betacellulin Uni-rAb® Recombinant Antibody for Sandwich ELISA, Indirect ELISA
Cat No. 83040-3-PBS
Clone No.230331H6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

BTC, Probetacellulin

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83040-3-PBS targets Betacellulin as part of a matched antibody pair:

MP00138-1: 83040-3-PBS capture and 83040-2-PBS detection (validated in Sandwich ELISA)

MP00138-2: 83040-3-PBS capture and 83040-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Affinity
KD=1.77 x 10-9M
KOff=2.71 x 10-4M
KOn=1.53 x 105M
Immunogen

CatNo: Ag26724

Product name: Recombinant human BTC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-118 aa of BC011618

Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ

Predict reactive species
Full Name betacellulin
Calculated Molecular Weight 20 kDa
GenBank Accession NumberBC011618
Gene Symbol BTC
Gene ID (NCBI) 685
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35070
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...