BTF3L4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BTF3L4 Polyclonal antibody (16500-1-AP)

BTF3L4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16500-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Basic transcription factor 3-like 4, BTF3 L4

• 

  WB analysis using 16500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16500-1-AP (BTF3L4 antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 16500-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16500-1-AP (BTF3L4 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 16500-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16500-1-AP (BTF3L4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BTF3L4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, Jurkat cells
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16500-1-AP targets BTF3L4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9666

  Product name: Recombinant human BTF3L4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-158 aa of BC022371

  Sequence: MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN

• Full Name: basic transcription factor 3-like 4
• Calculated Molecular Weight: 158 aa, 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC022371
• Gene Symbol: BTF3L4
• Gene ID (NCBI): 91408
• RRID: AB_2878265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96K17
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BTF3L4 Polyclonal antibody (Cat# 16500-1-AP) has a total of 4 citations appearing in Cell Discovery, Biology Direct, Development, and Frontiers in Oncology. The associated research fields span cuproptosis and alternative polyadenylation, gastric cancer and microRNA biogenesis regulation, spermiogenesis and mitochondrial function maintenance, and gastrointestinal cancer prognostic biomarker discovery.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Discov; NUDT21 lactylation reprograms alternative polyadenylation to promote cuproptosis resistance; Authors - Jinlong Lin
human	WB	Biol Direct; MIR194-2HG, a miRNA host gene activated by HNF4A, inhibits gastric cancer by regulating microRNA biogenesis; Authors - Hong Cao
		Development; FBXO24 targets SLC25A26 for K6-linked polyubiquitylation to maintain mitochondrial function during spermiogenesis.; Authors - Yunlong Zheng
human	WB	Front Oncol; Genome-wide association studies identify miRNA-194 as a prognostic biomarker for gastrointestinal cancer by targeting ATP6V1F, PPP1R14B, BTF3L4 and SLC7A5; Authors - Pan Huang