BTF3L4 Polyclonal antibody

• 

  WB analysis using 16500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16500-1-AP (BTF3L4 antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

• 

  IHC staining of rat brain using 16500-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16500-1-AP (BTF3L4 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 16500-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16500-1-AP (BTF3L4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BTF3L4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16500-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

BTF3L4, RP4 800M22.5

---

Tested Applications

• Positive WB detected in: HEK-293T cells, Jurkat cells
• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

16500-1-AP targets BTF3L4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9666

  Product name: Recombinant human BTF3L4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-158 aa of BC022371

  Sequence: MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN

• Full Name: basic transcription factor 3-like 4
• Calculated Molecular Weight: 158 aa, 17 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC022371
• Gene Symbol: BTF3L4
• Gene ID (NCBI): 91408
• RRID: AB_2878265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96K17
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Genome-wide association studies identify miRNA-194 as a prognostic biomarker for gastrointestinal cancer by targeting ATP6V1F, PPP1R14B, BTF3L4 and SLC7A5; Authors - Pan Huang
human	WB	Biol Direct; MIR194-2HG, a miRNA host gene activated by HNF4A, inhibits gastric cancer by regulating microRNA biogenesis; Authors - Hong Cao
human	WB	Cell Discov; NUDT21 lactylation reprograms alternative polyadenylation to promote cuproptosis resistance; Authors - Jinlong Lin