BTK Polyclonal antibody

• 

  WB analysis using 21581-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21581-1-AP (BTK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21581-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21581-1-AP (BTK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse spleen using 21581-1-AP

  IP result of anti-BTK (IP:21581-1-AP, 4ug; Detection:21581-1-AP 1:3000) with mouse spleen tissue lysate 1920 ug.

BTK Polyclonal Antibody for WB, IP, ELISA

Cat No. 21581-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

EC:2.7.10.2, BPK, B-cell progenitor kinase, ATK, AGMX1

---

Tested Applications

• Positive WB detected in: Daudi cells, Ramos cells, HT-29 cells, NIH/3T3 cells
• Positive IP detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

21581-1-AP targets BTK in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16133

  Product name: Recombinant human BTK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-184 aa of BC109079

  Sequence: RLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKT

• Full Name: Bruton agammaglobulinemia tyrosine kinase
• Calculated Molecular Weight: 659 aa, 76 kDa
• Observed Molecular Weight: 70-76 kDa
• GenBank Accession Number: BC109079
• Gene Symbol: BTK
• Gene ID (NCBI): 695
• RRID: AB_10734434
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06187
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Anoctamin 1 controls bone resorption by coupling Cl- channel activation with RANKL-RANK signaling transduction.; Authors - Weijia Sun
human	WB	Int J Mol Med; Overexpression of FcγRIIB regulates downstream protein phosphorylation and suppresses B cell activation to ameliorate systemic lupus erythematosus.; Authors - Linlin Sheng
mouse	WB	Redox Biol; CXCR4-BTK axis mediate pyroptosis and lipid peroxidation in early brain injury after subarachnoid hemorrhage via NLRP3 inflammasome and NF-κB pathway; Authors - Chengli Liu
human	WB,IHC	J Cancer; Identification and validation of a novel apoptosis-related prognostic risk score model for lung adenocarcinoma; Authors - Yan Wang
human	WB	Cell Death Discov; Tuning the B-CLL microenvironment: evidence for BAG3 protein- mediated regulation of stromal fibroblasts activity; Authors - Anna Basile