BTN2A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BTN2A2 Polyclonal antibody, PBS Only (16482-1-PBS)

• 

  WB analysis of MCF-7 using 16482-1-AP (same clone as 16482-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16482-1-AP (BTN2A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16482-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 16482-1-AP (same clone as 16482-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16482-1-AP (BTN2A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16482-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 16482-1-AP (same clone as 16482-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 16482-1-AP (BTN2A2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16482-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 16482-1-AP (same clone as 16482-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16482-1-AP (BTN2A2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16482-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 16482-1-AP (same clone as 16482-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16482-1-AP (BTN2A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16482-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16482-1-AP (same clone as 16482-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using BTN2A2 antibody (16482-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16482-1-PBS in a different storage buffer formulation.

BTN2A2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16482-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16482-1-PBS targets BTN2A2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9603

  Product name: Recombinant human BTN2A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-523 aa of BC014021

  Sequence: VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTLEMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDDSPIFICPALTGASGVMVPEEGLKLHRVGTHQSL

• Full Name: butyrophilin, subfamily 2, member A2
• Calculated Molecular Weight: 523 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC014021
• Gene Symbol: BTN2A2
• Gene ID (NCBI): 10385
• RRID: AB_2228110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVV5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Butyrophilins constitute a family of transmembrane proteins consisting of butyrophilin (BTN), BTN-like (BTNL), and selection and upkeep of intraepithelial T cell (SKI NT) proteins. It has been reported that BTN2A2 is expressed on B cells, DCs, and macrophages and the expression levels are upregulated upon activation. BTN2A2 is also expressed on thymic epithelial cells (TECs). The BTN2A2 putative receptor is expressed on activated T cells. BTN2A2 protein inhibits T cell proliferation, metabolism and Th1 cytokine production(PMID: 34588505). The calculated MW of BTN2A2 is 59kDa, and the glycosylated form is around 65kDa (PMID:20208008).