BTN3A1 Polyclonal antibody

• 

  WB analysis of U-937 using 25221-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 25221-1-AP (BTN3A1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25221-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25221-1-AP (BTN3A1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U-251 using 25221-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using BTN3A1 antibody (25221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

BTN3A1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25221-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CD277, BTF5, BT3.1

---

Tested Applications

• Positive WB detected in: U-937 cells, Jurkat cells
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

25221-1-AP targets BTN3A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18414

  Product name: Recombinant human BTN3A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 267-336 aa of BC121800

  Sequence: GYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKAL

• Full Name: butyrophilin, subfamily 3, member A1
• Calculated Molecular Weight: 513 aa, 58 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC121800
• Gene Symbol: BTN3A1
• Gene ID (NCBI): 11119
• RRID: AB_2879969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00481
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BTN3A1, also named as Butyrophilin subfamily 3 member A1 or BTF5, is a 513 amino acid protein ,which contains one B30.2/SPRY domain and two Ig-like V-type (immunoglobulin-like) domains. BTN3A1 localizes in the cell membrane and belongs to the immunoglobulin superfamily. BTN/MOG family. BTN3A1 is detected on T-cells, natural killer cells, dendritic cells and macrophages. It is ubiquitously highly expressed in heart, pancreas and lung and moderately expressed in placenta, liver and muscle. BTN3A1 plays a role in T-cell activation and in the adaptive immune response. It also regulates the proliferation of activated T-cells and the release of cytokines and IFNG by activated T-cells. It exists as four isoforms. We detected a 48 kda isoform by western blot.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; The ATP-binding cassette transporter A1 regulates phosphoantigen release and Vγ9Vδ2 T cell activation by dendritic cells.; Authors - Barbara Castella ; KD Validated
human	IHC	Front Oncol; Transcriptome-Based Network Analysis Unveils Eight Immune-Related Genes as Molecular Signatures in the Immunomodulatory Subtype of Triple-Negative Breast Cancer.; Authors - Jinguo Zhang
human	WB	Biochem Biophys Res Commun; Expression level of BTN3A1 on the surface of CD14+ monocytes is a potential predictor of γδ T cell expansion efficiency.; Authors - Mako Tomogane
human	WB, IHC	FEBS Open Bio; Comprehensive analysis of BTN3A1 in cancers: mining of omics data and validation in patient samples and cellular models.; Authors - Fan Liang