BUB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BUB3 Polyclonal antibody (27073-1-AP)

BUB3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27073-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, ELISA

Synonyms

BUB3, BUB3L, hBUB3

• 

  WB analysis using 27073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27073-1-AP (BUB3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 27073-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27073-1-AP (BUB3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 27073-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27073-1-AP (BUB3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BUB3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, MCF-7 cells, C6 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27073-1-AP targets BUB3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25608

  Product name: Recombinant human BUB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 205-328 aa of BC005138

  Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT

• Full Name: budding uninhibited by benzimidazoles 3 homolog (yeast)
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC005138
• Gene Symbol: BUB3
• Gene ID (NCBI): 9184
• RRID: AB_2880743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43684
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BUB3 polyclonal antibody (Cat# 27073-1-AP) has 5 total citations. These appear in Nature Communications, Nucleic Acids Research, Journal of Biomedical Science, Cancer Gene Therapy, and Journal of Oncology. The associated research fields span DNA replication initiation, spindle assembly checkpoint regulation, chromosomal instability in prostate cancer, pan-cancer oncogenic properties, and renal cell carcinoma prognosis. All cited applications were Western blot in human samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation; Authors - Xiaohua Xu
human		Nucleic Acids Res; ULK1 phosphorylates Mad1 to regulate spindle assembly checkpoint.; Authors - Fengjie Yuan
human	WB	J Biomed Sci; BUB1B monoallelic germline variants contribute to prostate cancer predisposition by triggering chromosomal instability; Authors - Maria P Silva
human	WB	Cancer Gene Ther; Pan-cancer oncogenic properties and therapeutic potential of SF3B4; Authors - Yanmei Shi
human	WB	J Oncol; CDCA3 Predicts Poor Prognosis and Affects CD8+ T Cell Infiltration in Renal Cell Carcinoma; Authors - Yuanyuan Bai