BUB3 Polyclonal antibody

• 

  WB analysis using 27073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27073-1-AP (BUB3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 27073-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27073-1-AP (BUB3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 27073-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27073-1-AP (BUB3 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

BUB3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27073-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, ELISA

Synonyms

BUB3, BUB3L, hBUB3

---

Tested Applications

• Positive WB detected in: HEK-293T cells, MCF-7 cells, C6 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

27073-1-AP targets BUB3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25608

  Product name: Recombinant human BUB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 205-328 aa of BC005138

  Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT

• Full Name: budding uninhibited by benzimidazoles 3 homolog (yeast)
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC005138
• Gene Symbol: BUB3
• Gene ID (NCBI): 9184
• RRID: AB_2880743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43684
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation; Authors - Xiaohua Xu
human		Nucleic Acids Res; ULK1 phosphorylates Mad1 to regulate spindle assembly checkpoint.; Authors - Fengjie Yuan
human	WB	Cancer Gene Ther; Pan-cancer oncogenic properties and therapeutic potential of SF3B4; Authors - Yanmei Shi
human	WB	J Oncol; CDCA3 Predicts Poor Prognosis and Affects CD8+ T Cell Infiltration in Renal Cell Carcinoma; Authors - Yuanyuan Bai
human	WB	J Biomed Sci; BUB1B monoallelic germline variants contribute to prostate cancer predisposition by triggering chromosomal instability; Authors - Maria P Silva