BUD13 Polyclonal antibody

• 

  IHC staining of mouse testis using 20163-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20163-1-AP (BUD13 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 20163-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20163-1-AP (BUD13 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 20163-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using BUD13 antibody (20163-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

BUD13 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 20163-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BUD13 homolog

---

Tested Applications

• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IP: See 1 publications below

Product Information

20163-1-AP targets BUD13 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13665

  Product name: Recombinant human BUD13 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 260-619 aa of BC006350

  Sequence: DTQQLRRARHDSPDLAPNVTYSLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQKATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSERDELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNKKVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM

• Full Name: BUD13 homolog (S. cerevisiae)
• Calculated Molecular Weight: 619 aa, 71 kDa
• Observed Molecular Weight: 71-85 kDa
• GenBank Accession Number: BC006350
• Gene Symbol: BUD13
• Gene ID (NCBI): 84811
• RRID: AB_2878650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRD0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BUD13 homolog (BUD13) is a component of the retention and splicing (RES) complex, previously identified in yeast as a splicing factor affecting nuclear pre-mRNA retention. As an RNA binding protein (RBP), BUD13 expression is associated with poor prognosis and may be involved in the development and progression of hepatocellular carcinoma (PMID: 37605593).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	J Exp Med; Somatic gain-of-function mutations in BUD13 promote oncogenesis by disrupting Fbw7 function; Authors - Jianfeng Chen