Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Rat Beta-2-Microglobulin Rabbit Recombinant Antibody, PBS Only (98429-1-PBS)

Anti-Rat Beta-2-Microglobulin Rabbit Recombinant Antibody, PBS Only

Name: Anti-Rat Beta-2-Microglobulin Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98429-1-PBS-1MG

Beta-2-Microglobulin Uni-rAb^® Recombinant Antibody for FC

Cat No. 98429-1-PBS

Clone No. 250092C5

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

Synonyms

B2m, beta 2-Microglobulin, Beta-2-microglobulin form pI 5.3, CDABP0092, HDCMA22P

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC

FC experiment of rat bone marrow cells using 98429-1-RR (same clone as 98429-1-PBS)
1x10^6 rat bone marrow cells were surface stained with 0.25 ug Anti-Rat Beta-2-Microglobulin Rabbit RecAb (98429-1-RR, Clone: 250092C5) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98429-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 rat bone marrow cells were surface stained with 0.25 ug Anti-Rat Beta-2-Microglobulin Rabbit RecAb (98429-1-RR, Clone: 250092C5) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98429-1-PBS in a different storage buffer formulation.
FC experiment of rat bone marrow cells using 98429-1-RR (same clone as 98429-1-PBS)
1x10^6 rat bone marrow cells were surface stained with 0.25 ug Anti-Rat Beta-2-Microglobulin Rabbit RecAb (98429-1-RR, Clone: 250092C5) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98429-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 rat bone marrow cells were surface stained with 0.25 ug Anti-Rat Beta-2-Microglobulin Rabbit RecAb (98429-1-RR, Clone: 250092C5) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98429-1-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for Beta-2-Microglobulin in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98429-1-PBS targets Beta-2-Microglobulin in FC applications and shows reactivity with rat samples.

Tested Reactivity	rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg3270 Product name: Recombinant Rat Beta-2-Microglobulin protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-119 aa of NM_012512.2 Sequence: IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM Predict reactive species
Full Name	beta-2 microglobulin
Calculated Molecular Weight	14 kDa
GenBank Accession Number	NM_012512.2
Gene Symbol	B2m
Gene ID (NCBI)	24223
RRID	AB_3746067
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P07151
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Beta-2-microglobulin (B2M) is a component of MHC class I molecules, which are present on the surface of nearly all nucleated cells. It can be found in body fluids under physiologic conditions due to shedding from cell surfaces or intracellular release. B2M has various biological functions, including antigen presentation. Investigations reveal that increased synthesis and release of B2M are present in several malignant diseases.