Beta Actin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81119-1-RR (same clone as 81119-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81119-1-RR (beta actin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81119-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 81119-1-RR (same clone as 81119-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Beta Actin antibody (81119-1-RR, Clone: 1E19 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 81119-1-PBS in a different storage buffer formulation.

Beta Actin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 81119-1-PBS

Clone No.1E19

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ACTB, Actin, bate actin, β actin, Actin cytoplasmic 1

---

Product Information

81119-1-PBS targets Beta Actin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14521

  Product name: Recombinant human beta actin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC002409

  Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK

• Full Name: actin, beta
• Calculated Molecular Weight: 375 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC002409
• Gene Symbol: Beta Actin
• Gene ID (NCBI): 60
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P60709
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta Actin, a 42-kDa protein encoded by the ACTB gene, is a highly conserved, ubiquitous protein that forms microfilaments, making it a major component of the cell's cytoskeleton and contractile apparatus. It plays essential roles in cell structure, growth, motility, and intracellular transport, and it's also involved in gene expression regulation by associating with chromatin remodeling complexes. Due to its stable and constitutive expression across different tissues and under most experimental conditions, beta-actin is extensively utilized as an internal loading control in molecular biology techniques, including Western blotting, quantitative PCR (qPCR), and immunohistochemistry, for normalizing gene and protein expression data. Based on epitope identification, this antibody specifically recognizes ACTB and does not exhibit cross-reactivity with ACTA1/ACTA2.