Beta Arrestin 2 Monoclonal antibody

• 

  WB analysis using 68502-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68502-1-Ig (Beta Arrestin 2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 68502-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 68502-1-Ig (Beta Arrestin 2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 68502-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68502-1-Ig (Beta Arrestin 2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 68502-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 68502-1-Ig (Beta Arrestin 2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 68502-1-Ig

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 68502-1-Ig (Beta Arrestin 2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 68502-1-Ig

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 68502-1-Ig (Beta Arrestin 2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 68502-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Beta Arrestin 2 antibody (68502-1-Ig, Clone: 1E8F2 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-phalloidin (red).

Beta Arrestin 2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68502-1-Ig

Clone No.1E8F2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ARRB2, β-Arrestin 2, BARR2, Arrestin beta-2, ARR2

---

Tested Applications

• Positive WB detected in: LNCaP cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HeLa cells, MCF-7 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68502-1-Ig targets Beta Arrestin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29807

  Product name: Recombinant human Beta Arrestin 2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 163-409 aa of BC007427

  Sequence: NSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

• Full Name: arrestin, beta 2
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC007427
• Gene Symbol: Beta Arrestin 2
• Gene ID (NCBI): 409
• RRID: AB_3085213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P32121
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta Arrestin 2 is a member of arrestin/beta-arrestin protein family, which are expressed at high levels in the central nervous system (CNS) and play a critical role in the regulation of G-protein coupled receptors (GPCRs) including MOR. Beta Arrestin 2 is an adaptor protein that is important for the regulation of receptors belonging to both dopaminergic and opioid systems. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.