Beta Arrestin 2 Recombinant monoclonal antibody, PBS Only

Beta Arrestin 2 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 82780-6-PBS
Clone No.241470F8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

ARRB2, β-Arrestin 2, 241470F8, ARB2, ARR2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82780-6-PBS targets Beta Arrestin 2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0227

Product name: Recombinant human Beta Arrestin 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 163-409 aa of BC007427

Sequence: NSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

Predict reactive species
Full Name arrestin, beta 2
Calculated Molecular Weight 46 kDa
Observed Molecular Weight47-50 kDa
GenBank Accession NumberBC007427
Gene Symbol Beta Arrestin 2
Gene ID (NCBI) 409
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP32121
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Beta Arrestin 2 is a member of arrestin/beta-arrestin protein family, which are expressed at high levels in the central nervous system (CNS) and play a critical role in the regulation of G-protein coupled receptors (GPCRs) including MOR. Beta Arrestin 2 is an adaptor protein that is important for the regulation of receptors belonging to both dopaminergic and opioid systems. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.

Loading...
||
New chat Able
正在加载,请稍候...