Beta Arrestin 2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01125-4

  Sandwich ELISA standard curve of MP01125-4, Human Beta Arrestin 2 Recombinant Matched Antibody Pair - PBS only. 82780-7-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0227. 82780-4-PBS was HRP conjugated as the detection antibody. Range: 0.313-10 ng/mL.

• 

  Sample test of MP01125-4

  The mean Beta Arrestin 2 concentration was determined to be 9.58 ng/mL in HT-29 cell extract based on a 1.30 mg/mL extract load and 5.35 ng/mL in mouse brain tissue extract based on a 2.00 mg/mL extract load.

Beta Arrestin 2 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 82780-7-PBS

Clone No.241470G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

ARRB2, β-Arrestin 2, ARB2, ARR2, Arrestin beta-2

---

Product Information

82780-7-PBS targets Beta Arrestin 2 as part of a matched antibody pair:

MP01125-4: 82780-7-PBS capture and 82780-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0227

  Product name: Recombinant human Beta Arrestin 2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 163-409 aa of BC007427

  Sequence: NSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

• Full Name: arrestin, beta 2
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: BC007427
• Gene Symbol: Beta Arrestin 2
• Gene ID (NCBI): 409
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P32121
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.