CoraLite® Plus 750-conjugated Beta Tubulin Monoclonal antibody

Beta Tubulin Monoclonal Antibody for WB

Cat No. CL750-66240
Clone No.1D4A4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, nematode, pig, zebrafish

Applications

WB

beta 4, beta tubulin, MC1R, TUBB, TUBB3, TUBB4, Tubulin beta 3 chain, Tubulin beta 4 chain, Tubulin beta III, tubulin, beta 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells. HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-66240 targets Beta Tubulin in WB applications and shows reactivity with human, mouse, rat, nematode, pig, zebrafish samples.

Tested Reactivity human, mouse, rat, nematode, pig, zebrafish
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0117

Product name: Recombinant human Tubulin-beta protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 44-259 aa of BC000748

Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

Predict reactive species
Full Name tubulin, beta 3
Calculated Molecular Weight 450 aa, 50 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC000748
Gene Symbol TUBB3
Gene ID (NCBI) 10381
RRIDAB_3086570
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13509
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The alpha and beta tubulins (+/- 55 kDa MW) are homologous but are not identical. Beta tubulins have been widely used as loading control.

 

What is the molecular weight of beta-tubulin? Are there any isoforms of beta-tubulin?

The molecular weight of tubulin is 50-52 kDa. Humans have eight beta-tubulin isotypes, encoded by different genes, that differ in their C-terminal sequences. They have different tissue expression profiles and can rise to microtubules of different properties (PMID: 20191564).

 

How to use beta-tubulin as a loading control

Beta-tubulin is one of the most commonly used references as a loading control for cell lysates in western blotting. It is abundantly expressed across various tissues and developmental stages and highly conserved across species. However, since some variability has been observed in the expression levels of commonly used housekeeping genes (PMID: 15627964), it is recommended that more than one loading control antibody is used while developing new assays. More information can be found here: https://www.ptglab.com/news/blog/loading-control-antibodies-for-western-blotting/.

 

What drugs can influence beta-tubulin and organization of microtubules?

Many drugs that affect microtubule dynamics target beta-tubulin, mainly by interfering with the GTP hydrolysis (PMID: 21381049). Paclitaxel (Taxol) is used to stabilize microtubules by slowing down their depolymerization, while colchicine and vinca alkaloids (vinblastine) destabilize microtubules. They are used in research and also in the clinic as anti-cancer agents.

 

Is beta-tubulin post-translationally modified?

Yes, tubulins are subject to extensive post-translational modifications (PTMs) that affect the organization of microtubules and their dynamics. The most common modifications include polyglutamylation, polyglycylation, polyamination, glycososylation, glycation, phosphorylation, and acetylation (PMID: 24801181 and 25468068).

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 Beta Tubulin antibody CL750-66240Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...