Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated Beta Tubulin Monoclonal antibody

Beta Tubulin Monoclonal Antibody for WB, IF/ICC, FC (Intra)

Cat No. CL488-66240
Clone No.1D4A4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, zebrafish, nematode

Applications

WB, IF/ICC, FC (Intra)

Tubulin beta 3 chain, Tubulin beta III, β III tubulin , βIII tubulin , 1D4A4

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66240 targets Beta Tubulin in WB, IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig, zebrafish, nematode samples.

Tested Reactivity human, mouse, rat, pig, zebrafish, nematode
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0117

Product name: Recombinant human Tubulin-beta protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 44-259 aa of BC000748

Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

Predict reactive species
Full Name tubulin, beta 3
Calculated Molecular Weight 450 aa, 50 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC000748
Gene Symbol TUBB3
Gene ID (NCBI) 10381
RRIDAB_2883292
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13509
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The alpha and beta tubulins (+/- 55 kDa MW) are homologous but are not identical. Beta tubulins have been widely used as loading control.

 

What is the molecular weight of beta-tubulin? Are there any isoforms of beta-tubulin?

The molecular weight of tubulin is 50-52 kDa. Humans have eight beta-tubulin isotypes, encoded by different genes, that differ in their C-terminal sequences. They have different tissue expression profiles and can rise to microtubules of different properties (PMID: 20191564).

 

How to use beta-tubulin as a loading control

Beta-tubulin is one of the most commonly used references as a loading control for cell lysates in western blotting. It is abundantly expressed across various tissues and developmental stages and highly conserved across species. However, since some variability has been observed in the expression levels of commonly used housekeeping genes (PMID: 15627964), it is recommended that more than one loading control antibody is used while developing new assays. More information can be found here: https://www.ptglab.com/news/blog/loading-control-antibodies-for-western-blotting/.

 

What drugs can influence beta-tubulin and organization of microtubules?

Many drugs that affect microtubule dynamics target beta-tubulin, mainly by interfering with the GTP hydrolysis (PMID: 21381049). Paclitaxel (Taxol) is used to stabilize microtubules by slowing down their depolymerization, while colchicine and vinca alkaloids (vinblastine) destabilize microtubules. They are used in research and also in the clinic as anti-cancer agents.

 

Is beta-tubulin post-translationally modified?

Yes, tubulins are subject to extensive post-translational modifications (PTMs) that affect the organization of microtubules and their dynamics. The most common modifications include polyglutamylation, polyglycylation, polyamination, glycososylation, glycation, phosphorylation, and acetylation (PMID: 24801181 and 25468068).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Beta Tubulin antibody CL488-66240Download protocol
IF protocol for CL Plus 488 Beta Tubulin antibody CL488-66240Download protocol
WB protocol for CL Plus 488 Beta Tubulin antibody CL488-66240Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cancer Cell

Adeno-to-squamous transition drives resistance to KRAS inhibition in LKB1 mutant lung cancer

Authors - Xinyuan Tong
IF

Curr Biol

Gatekeeper function for Short stop at the ring canals of the Drosophila ovary.

Authors - Wen Lu
humanIF

Cell Chem Biol

S1PR3-G12-biased agonist ALESIA targets cancer metabolism and promotes glucose starvation.

Authors - Masayasu Toyomoto
IF

Elife

A novel mechanism of bulk cytoplasmic transport by cortical dynein in Drosophila ovary.

Authors - Wen Lu
humanIF

Mol Ther Nucleic Acids

Non-targeting control for MISSION shRNA library silences SNRPD3 leading to cell death or permanent growth arrest.

Authors - Maria Czarnek
mouseIF

Front Cell Dev Biol

Caffeine Induces Autophagy and Apoptosis in Auditory Hair Cells via the SGK1/HIF-1α Pathway.

Authors - Xiaomin Tang
Loading...
||
New chat

Able

正在加载,请稍候...