C10orf104 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C10orf104 Polyclonal antibody, PBS Only (26324-1-PBS)

• 

  IP experiment of HEK-293 using 26324-1-AP (same clone as 26324-1-PBS)

  IP result of anti-C10orf104 (IP:26324-1-AP, 4ug; Detection:26324-1-AP 1:800) with HEK-293 cells lysate 1440 ug. This data was developed using the same antibody clone with 26324-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 26324-1-AP (same clone as 26324-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 26324-1-AP (C10orf104 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26324-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 26324-1-AP (same clone as 26324-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using C10orf104 antibody (26324-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 26324-1-PBS in a different storage buffer formulation.

C10orf104 Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 26324-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IP, ELISA

Synonyms

ANAPC16, Anaphase-promoting complex subunit 16, APC16, CENP-27, Cyclosome subunit 16

---

Product Information

26324-1-PBS targets C10orf104 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23641

  Product name: Recombinant human C10orf104 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC009530

  Sequence: MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG

• Full Name: chromosome 10 open reading frame 104
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC009530
• Gene Symbol: C10orf104
• Gene ID (NCBI): 119504
• RRID: AB_3742181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DE5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C10orf104 (also known as ANAPC16 or APC16) is a protein associated with the anaphase-promoting complex/cyclosome (APC/C). APC/C is a highly conserved E3 ubiquitin ligase that regulates various stages of the cell cycle, particularly the transition from mitotic to non-mitotic phases and the entry into the G1 phase during mitosis. As a subunit of APC/C, C10orf104 contributes to its stability and modulates its ubiquitin ligase activity.