Product Information
33819-1-PBS targets C10orf35 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36807 Product name: Recombinant human C10orf35 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC013587 Sequence: MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTS Predict reactive species |
| Full Name | chromosome 10 open reading frame 35 |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC013587 |
| Gene Symbol | C10orf35 |
| Gene ID (NCBI) | 219738 |
| RRID | AB_3743081 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96D05 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

