C10orf35 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C10orf35 Polyclonal antibody, PBS Only (33819-1-PBS)

• 

  WB analysis using 33819-1-AP (same clone as 33819-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33819-1-AP (C10orf35 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33819-1-PBS in a different storage buffer formulation.

C10orf35 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33819-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FAM241B, Protein FAM241B

---

Product Information

33819-1-PBS targets C10orf35 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36807

  Product name: Recombinant human C10orf35 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-91 aa of BC013587

  Sequence: MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMGFPQWHLGNHAVEPVTS

• Full Name: chromosome 10 open reading frame 35
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC013587
• Gene Symbol: C10orf35
• Gene ID (NCBI): 219738
• RRID: AB_3743081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96D05
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.