C11orf49 Polyclonal antibody

• 

  WB analysis of mouse lung using 20195-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 20195-1-AP (C11orf49 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 20195-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 20195-1-AP (C11orf49 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 20195-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 20195-1-AP (C11orf49 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 20195-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 20195-1-AP (C11orf49 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 20195-1-AP

  Immunofluorescent analysis of HepG2 cells, using C11orf49 antibody 20195-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

C11orf49 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20195-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Centriolar satellite-associated tubulin polyglutamylase complex regulator 1, CSTPP1

---

Tested Applications

• Positive WB detected in: mouse lung tissue, human brain tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

20195-1-AP targets C11orf49 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14123

  Product name: Recombinant human C11orf49 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC001860

  Sequence: MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQATPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET

• Full Name: chromosome 11 open reading frame 49
• Calculated Molecular Weight: 331 aa, 37 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC001860
• Gene Symbol: C11orf49
• Gene ID (NCBI): 79096
• RRID: AB_10646431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6J7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cell; Dual proteome-scale networks reveal cell-specific remodeling of the human interactome.; Authors - Edward L Huttlin