C11orf67 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C11orf67 Polyclonal antibody, PBS Only (20414-1-PBS)

• 

  WB analysis of mouse testis using 20414-1-AP (same clone as 20414-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 20414-1-AP (C11orf67 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20414-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 20414-1-AP (same clone as 20414-1-PBS)

  WB result of C11orf67 antibody (20414-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-C11orf67 transfected HepG2 cells. This data was developed using the same antibody clone with 20414-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 20414-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 20414-1-AP (C11orf67 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 20414-1-AP (same clone as 20414-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 20414-1-AP (C11orf67 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 20414-1-AP (same clone as 20414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 20414-1-AP (C11orf67 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20414-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 20414-1-AP (same clone as 20414-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 20414-1-AP (C11orf67 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20414-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C11orf67 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20414-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

AAMDC, Adipogenesis associated Mth938 domain-containing protein, CK067, Mth938 domain-containing protein, PTD015

---

Product Information

20414-1-PBS targets C11orf67 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14258

  Product name: Recombinant human C11orf67 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC002752

  Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC

• Full Name: chromosome 11 open reading frame 67
• Calculated Molecular Weight: 122 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC002752
• Gene Symbol: C11orf67
• Gene ID (NCBI): 28971
• RRID: AB_10694438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7C9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C11orf67 is predicted to be involved in positive regulation of fat cell differentiation.