C11orf70 Polyclonal antibody

C11orf70 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 20780-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

CFAP300, Cilia- and flagella-associated protein 300, CK070

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, MCF-7 cells
Positive IHC detected inhuman testis tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20780-1-AP targets C11orf70 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14793

Product name: Recombinant human C11orf70 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-229 aa of BC006128

Sequence: MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS

Predict reactive species
Full Name chromosome 11 open reading frame 70
Calculated Molecular Weight 267 aa, 31 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC006128
Gene Symbol C11orf70
Gene ID (NCBI) 85016
RRIDAB_10755147
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BRQ4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The CFAP300 protein is an important member of the cilia- and flagella-associated protein family, localized in the basal body and axoneme structures of cellular cilia. It plays a central role in ciliary assembly and stability, primarily by participating in the transport and anchoring of pre-assembled complexes within the cytoplasm. Research indicates that mutations in the CFAP300 gene lead to structural and functional defects in cilia, which are closely associated with various human ciliopathies, such as primary ciliary dyskinesia, heterotaxy, and male infertility. Loss of its function disrupts intraflagellar transport, affecting key physiological processes including left-right axis determination during embryonic development and mucociliary clearance in the respiratory tract. Therefore, CFAP300 is a crucial protein molecule for understanding ciliary biology and the mechanisms of related diseases.

Protocols

Product Specific Protocols
IF protocol for C11orf70 antibody 20780-1-APDownload protocol
IHC protocol for C11orf70 antibody 20780-1-APDownload protocol
WB protocol for C11orf70 antibody 20780-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...