C11orf74 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 25758-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25758-1-AP (C11orf74 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 25758-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25758-1-AP (C11orf74 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 25758-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25758-1-AP (C11orf74 Antibody) at dilution of 1:50 (under 40x lens).

C11orf74 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25758-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

C11orf74, Protein HEPIS

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25758-1-AP targets C11orf74 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22770

  Product name: Recombinant human C11orf74 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-221 aa of BC051031

  Sequence: MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVTHKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCIPFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD

• Full Name: chromosome 11 open reading frame 74
• Calculated Molecular Weight: 221 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC051031
• Gene Symbol: C11orf74
• Gene ID (NCBI): 119710
• RRID: AB_2880227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C11orf74, also named as Protein HEPIS, has two isoforms with MW 25 kDa and 17 kDa.