DDIAS Polyclonal antibody

• 

  WB analysis using 27754-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27754-1-AP (C11orf82 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

DDIAS Polyclonal Antibody for WB, ELISA

Cat No. 27754-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C11orf82, DNA Damage Induced Apoptosis Suppressor, DNA damage-induced apoptosis suppressor protein, Nitric oxide-inducible gene protein, noxin

---

Tested Applications

• Positive WB detected in: HepG2 cells, K-562 cells, NCI-H1299 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27754-1-AP targets DDIAS in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26829

  Product name: Recombinant human C11orf82 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-170 aa of BC039268

  Sequence: IYPSCQKCFSRIILVSKRSNCPKCGSTGESGNANYRYKLSLKVAESNKLFVITVFGSCLDTFFGLTATGLHRYIQDPNKIPETLDNDTTQNLLTKAVETCFVGQSFIFGVTNFENQPGQGSDASNFLQQCSDHKRKAKALVACQIVLPDP

• Full Name: chromosome 11 open reading frame 82
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC039268
• Gene Symbol: C11orf82
• Gene ID (NCBI): 220042
• RRID: AB_3669620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXT1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA damage-induced apoptosis suppressor (DDIAS) is an oncogenic protein that is highly expressed in several cancers, including colorectal, lung, breast, and hepatocellular carcinoma (HCC), and stimulates cancer cell proliferation and cell cycle progression.DDIAS protects cancer cells from DNA damage reagents and tumor necrosis factor-associated apoptosis-inducing ligands (TRAILs) and positively regulates cancer cell invasion by stabilizing the β- catenin positively regulates cancer cell invasion. Therefore, DDIAS is considered as a potential therapeutic target for malignant lung cancer.