C11orf83 Polyclonal antibody

• 

  IHC staining of human breast cancer using 25651-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25651-1-AP (C11orf83 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 25651-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25651-1-AP (C11orf83 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human placenta using 25651-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25651-1-AP (C11orf83 Antibody) at dilution of 1:50 (under 40x lens).

C11orf83 Polyclonal Antibody for IHC, ELISA

Cat No. 25651-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

C11orf83, CCDS41658.1, UNQ655, UPF0723 protein C11orf83

---

Tested Applications

• Positive IHC detected in: human placenta tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25651-1-AP targets C11orf83 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22442

  Product name: Recombinant human C11orf83 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-94 aa of BC090057

  Sequence: VIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATTQENVAWRKNWMVGGEGGASGRSP

• Full Name: chromosome 11 open reading frame 83
• Calculated Molecular Weight: 93 aa, 10 kDa
• GenBank Accession Number: BC090057
• Gene Symbol: C11orf83
• Gene ID (NCBI): 790955
• RRID: AB_2880176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UW78
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.