C12orf43 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C12orf43 Polyclonal antibody (33971-1-AP)

• 

  WB analysis of LNCaP using 33971-1-AP

  WB result of C12orf43 antibody (33971-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C12orf43 transfected LNCaP cells.

• 

  WB analysis using 33971-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33971-1-AP (C12orf43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• KD/KO Validated

C12orf43 Polyclonal Antibody for WB, ELISA

Cat No. 33971-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Chromosome 12 Open Reading Frame 43, CUSTOS, Protein CUSTOS

---

Tested Applications

• Positive WB detected in: A549 cells, LNCaP cells, ACHN cells, Calu-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33971-1-AP targets C12orf43 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40576

  Product name: Recombinant human C12orf43 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-142 aa of BC014661

  Sequence: AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQPR

• Full Name: chromosome 12 open reading frame 43
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC014661
• Gene Symbol: C12orf43
• Gene ID (NCBI): 64897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96C57
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C12orf43 (also known as CUSTOS) is a nuclear-localized protein. It is predicted to be involved in the formation of the Spemann organizer, a key process in embryonic development, and acts as a negative regulator of the Wnt signaling pathway. Studies have shown that C12orf43 is differentially expressed in various tumors, and its high expression in liver cancer and lung cancer is significantly associated with poor patient prognosis, establishing it as an unfavorable prognostic marker. Additionally, C12orf43 has been found to be associated with neurodegenerative diseases, autoimmune disorders, and other conditions.