C12orf65 Polyclonal antibody

• 

  IHC staining of human kidney using 24646-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24646-1-AP (C12orf65 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 24646-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24646-1-AP (C12orf65 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C12orf65 Polyclonal Antibody for IHC, ELISA

Cat No. 24646-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

C12orf65

---

Tested Applications

• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24646-1-AP targets C12orf65 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19965

  Product name: Recombinant human C12orf65 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 11-94 aa of BC062329

  Sequence: TPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVK

• Full Name: chromosome 12 open reading frame 65
• Calculated Molecular Weight: 166 aa, 19 kDa
• GenBank Accession Number: BC062329
• Gene Symbol: C12orf65
• Gene ID (NCBI): 91574
• RRID: AB_2879653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3J6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis.