Tested Applications
| Positive IHC detected in | human kidney tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24646-1-AP targets MTRFR in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19965 Product name: Recombinant human C12orf65 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 11-94 aa of BC062329 Sequence: TPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVK Predict reactive species |
| Full Name | Mitochondrial translation release factor in rescue |
| Calculated Molecular Weight | 166 aa, 19 kDa |
| GenBank Accession Number | BC062329 |
| Gene Symbol | MTRFR |
| Gene ID (NCBI) | 91574 |
| RRID | AB_2879653 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3J6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MTRFR antibody 24646-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MTRFR (C12orf65) Polyclonal Antibody (Cat# 24646-1-AP) has a total of 1 citation. This citation appears in Nature Communications (IF 18.1), published in 2026 by Taisei Wakigawa et al. The research field is mitochondrial translation, specifically investigating termination, recycling, reinitiation, and rescue mechanisms for both in-frame and out-of-frame contexts.
| Species | Application | Title |
|---|---|---|
Nat Commun Mitochondrial translation termination, recycling, reinitiation, and rescue for in-frame and out-of-frame contexts. |
