C12orf69 Polyclonal antibody

• 

  WB analysis of mouse brain using 26099-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26099-1-AP (C12orf69 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 26099-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26099-1-AP (C12orf69 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 26099-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 26099-1-AP (C12orf69 antibody) at dilution of 1:200 (under 40x lens).

C12orf69 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26099-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SMCO3, Single-pass membrane and coiled-coil domain-containing protein 3

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26099-1-AP targets C12orf69 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23419

  Product name: Recombinant human C12orf69 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC132752

  Sequence: MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK

• Full Name: chromosome 12 open reading frame 69
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC132752
• Gene Symbol: C12orf69
• Gene ID (NCBI): 440087
• RRID: AB_2880375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A2RU48
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The function of C12orf69 remains largely unknown. Catalog#26099-1-AP is a rabbit polyclonal antibody raised against the full-length of human C12orf69. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein.