C13orf33 Polyclonal antibody

• 

  WB analysis of HepG2 using 26137-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26137-1-AP (C13orf33 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 26137-1-AP

  IP result of anti-C13orf33 (IP:26137-1-AP, 4ug; Detection:26137-1-AP 1:300) with HepG2 cells lysate 4000ug.

C13orf33 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26137-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

AWMS3, C13orf33, hAWMS3

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26137-1-AP targets C13orf33 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23516

  Product name: Recombinant human C13orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-303 aa of BC101626

  Sequence: MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVAGPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQFI

• Full Name: chromosome 13 open reading frame 33
• Observed Molecular Weight: 34-45 kDa
• GenBank Accession Number: BC101626
• Gene Symbol: C13orf33
• Gene ID (NCBI): 84935
• RRID: AB_2880396
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VYS4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.