Vertnin Polyclonal antibody

• 

  WB analysis of SGC-7901 using 24824-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 24824-1-AP (Vertnin antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 24824-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24824-1-AP (Vertnin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 24824-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 24824-1-AP (Vertnin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Vertnin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24824-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C14orf115, VRTN

---

Tested Applications

• Positive WB detected in: SGC-7901 cells
• Positive IHC detected in: human urothelial carcinoma tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24824-1-AP targets Vertnin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20678

  Product name: Recombinant human C14orf115 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-350 aa of BC053325

  Sequence: MTSRNQLVQKVLQELQEAVECEGLEGLIGASLEAKQVLSSFTLPTCREGGPGLQVLEVDSVALSLYPEDAPRNMLPLVCKGEGSLLFEAASMLLWGDAGLSLELRARTVVEMLLHRHYYLQGMIDSKVMLQAVRYSLCSEESPEMTSLPPATLEAIFDADVKASCFPSSFSNVWHLYALASVLQRNIYSIYPMRNLKIRPYFNRVIRPRRCDHVPSTLHIMWAGQPLTSHFFRHQYFAPVVGLEEVEAEGAPGVAPALPALAPLSSPAKTLELLNREPGLSYSHLCERYSVTKSTFYRWRRQSQEHRQKVAARFSAKHFLQDSFHRGGVVPLQQFLQRFPEISRSTYYAW

• Full Name: chromosome 14 open reading frame 115
• Calculated Molecular Weight: 702 aa, 78 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC053325
• Gene Symbol: Vertnin
• Gene ID (NCBI): 55237
• RRID: AB_2879745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8Y1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vertnin, also named as VRTN and C14orf115, belongs to the vertnin family. It is an essential factor for development of the embryo in a wide range of organisms.