C14orf126 Polyclonal antibody

• 

  WB analysis using 23923-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23923-1-AP (C14orf126 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 23923-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23923-1-AP (C14orf126 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 23923-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 23923-1-AP (C14orf126 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 23923-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using C14orf126 antibody (23923-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

C14orf126 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 23923-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Animalia-specific tRNA deacylase, ATD, D-aminoacyl-tRNA deacylase 2, DTD2, D-tyrosyl-tRNA(Tyr) deacylase 2

---

Tested Applications

• Positive WB detected in: A549 cells, mouse cerebellum tissue, HepG2 cells, mouse lung tissue
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23923-1-AP targets C14orf126 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21053

  Product name: Recombinant human C14orf126 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of BC010618

  Sequence: MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF

• Full Name: chromosome 14 open reading frame 126
• Calculated Molecular Weight: 168 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC010618
• Gene Symbol: C14orf126
• Gene ID (NCBI): 112487
• RRID: AB_3669426
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96FN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C14orf126, also named D-aminoacyl-tRNA deacylase 2 (DTD2), can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site. Plants are unique in possessing two distinct chiral proofreading systems, D-aminoacyl-tRNA deacylase1 (DTD1) and DTD2, of bacterial and archaeal origins, respectively.