Product Information
24737-1-PBS targets C14orf159 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20681 Product name: Recombinant human C14orf159 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-85 aa of BC065558 Sequence: MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSEPEKWMLPPQGAISET Predict reactive species |
| Full Name | chromosome 14 open reading frame 159 |
| Calculated Molecular Weight | 616 aa, 66 kDa |
| GenBank Accession Number | BC065558 |
| Gene Symbol | C14orf159 |
| Gene ID (NCBI) | 80017 |
| RRID | AB_2879698 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z3D6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

