C14orf73 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C14orf73 Polyclonal antibody (32933-1-AP)

• 

  WB analysis using 32933-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32933-1-AP (C14orf73 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

C14orf73 Polyclonal Antibody for WB, ELISA

Cat No. 32933-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Synonyms

EXOC3L4, Exocyst complex component 3-like protein 4

---

Tested Applications

• Positive WB detected in: A549 cells, U-251 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32933-1-AP targets C14orf73 in applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35995

  Product name: Recombinant human C14orf73 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC113655

  Sequence: MPSPQTDTPGPELQSPKEAEEPQTPAQGSRRTSSRKEPNAHRKDGTRLGLGSLRQAFSRASQRALTQVSKEDTGLFWRSSCSLFRSFRQALNEGPATGHSQATPEVPSGVMNGVSQQASTGAASEELKPEAEGKSVADLITERQLLAAFEQLLRLETLLVAEKASRTFEQDPTAFARRAMDVCLHYDGLAAEIGAIVRETLDSDGVDAAALAELARVVSAEEEAHPSPPDDGDFLRTPRRWRQHWEEAVRRSAQE

• Full Name: chromosome 14 open reading frame 73
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC113655
• Gene Symbol: C14orf73
• Gene ID (NCBI): 91828
• RRID: AB_3742795
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q17RC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C14orf73 (chromosome 14 open reading frame 73), also known as EXOC3L4 or SEC6-like protein C14orf73, is a protein composed of 722 amino acids and belongs to the SEC6 family. This protein is a component of the exocyst complex, which plays an important role in the cellular secretion process, participating in vesicle targeting and fusion. The C14orf73 protein is predicted to have SNARE binding activity, involved in the localization of the exocyst complex and exocytosis. Additionally, rare variants in the splicing regulatory elements of this gene are associated with Alzheimer's disease.