C15orf58 Polyclonal antibody

• 

  WB analysis of PC-3 using 25447-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25447-1-AP (C15orf58 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 25447-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25447-1-AP (C15orf58 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25447-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25447-1-AP (C15orf58 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of PC-3 using 25447-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 25447-1-AP (C15orf58 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

C15orf58 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25447-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

C15orf58, UPF0580 protein C15orf58

---

Tested Applications

• Positive WB detected in: PC-3 cells, mouse brain tissue
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25447-1-AP targets C15orf58 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20215

  Product name: Recombinant human C15orf58 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-170 aa of BC127821

  Sequence: MALPHDSNETSYLLPPNNEDWGGQTIPDFVYGQKDLTAEGIQWPRNAPGIPDALPQSPFDAALCSAWKQRVELGLFRYRLRELQTQILPGAVGFVAQLNVERGVQRRPPQTIKSVRQAFDPVQFNFNKIRPGEVLFRLHREPDLPGTLLQEDILVVINVSPLEWGHISEI

• Full Name: chromosome 15 open reading frame 58
• Calculated Molecular Weight: 385 aa, 42 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC127821
• Gene Symbol: C15orf58
• Gene ID (NCBI): 390637
• RRID: AB_2880085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZNW5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.