C15orf61 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C15orf61 Polyclonal antibody (33959-1-AP)

• 

  WB analysis using 33959-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33959-1-AP (C15orf61 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

C15orf61 Polyclonal Antibody for WB, ELISA

Cat No. 33959-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Uncharacterized protein C15orf61

---

Tested Applications

• Positive WB detected in: K-562 cells, MG-63 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33959-1-AP targets C15orf61 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38734

  Product name: Recombinant human C15orf61 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-157 aa of NM_001143936

  Sequence: MRPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSYGPITVYFLNKEDEGAMY

• Full Name: chromosome 15 open reading frame 61
• Calculated Molecular Weight: 18 aa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_001143936
• Gene Symbol: C15orf61
• Gene ID (NCBI): 145853
• RRID: AB_3743124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NNL5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.