C16orf14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C16orf14 Polyclonal antibody (20808-1-AP)

C16orf14 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20808-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

c349E10.1, FAM195A, MAPK regulated corepressor interacting protein 2, MCRIP2, Protein FAM195A

• 

  WB analysis using 20808-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20808-1-AP (C16orf14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skin using 20808-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 20808-1-AP (C16orf14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skin using 20808-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 20808-1-AP (C16orf14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 20808-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20808-1-AP (C16orf14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 20808-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20808-1-AP (C16orf14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 20808-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C16orf14 antibody (20808-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 20808-1-AP

  Immunofluorescent analysis of HepG2 cells, using C16orf14 antibody 20808-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C16orf14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse skin tissue, K-562 cells
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20808-1-AP targets C16orf14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14754

  Product name: Recombinant human C16orf14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-75 aa of BC007346

  Sequence: MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSLAAGATAAGWWPSR

• Full Name: chromosome 16 open reading frame 14
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 8 kDa, 18 kDa
• GenBank Accession Number: BC007346
• Gene Symbol: C16orf14
• Gene ID (NCBI): 84331
• RRID: AB_10700013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUT9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The C16orf14 polyclonal antibody (Cat# 20808-1-AP) has 3 total citations. These appear in Biomolecules, bioRxiv, and Nature Communications. The cited research spans RNA biology and cancer, specifically involving stress granule protein interactome analysis of an RNA helicase and the role of a cancer-associated noncoding RNA (snaR-A) in disrupting core splicing machinery and mRNA processing.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Biomolecules; Comprehensive Protein Interactome Analysis of a Key RNA Helicase: Detection of Novel Stress Granule Proteins.; Authors - Rebecca Bish
human	WB	bioRxiv; Cancer-associated snaR-A noncoding RNA interacts with core splicing machinery and disrupts processing of mRNA subpopulations; Authors - Sihang Zhou
		Nat Commun; Cancer-associated snaR-A noncoding RNA interacts with core splicing machinery and disrupts processing of mRNA subpopulations.; Authors - Sihang Zhou