C16orf74 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C16orf74 Polyclonal antibody, PBS Only (30246-1-PBS)

C16orf74 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30246-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Uncharacterized protein C16orf74

• 

  WB analysis using 30246-1-AP (same clone as 30246-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30246-1-AP (C16orf74 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30246-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 30246-1-AP (same clone as 30246-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30246-1-AP (C16orf74 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30246-1-PBS in a different storage buffer formulation.

---

Product Information

30246-1-PBS targets C16orf74 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32878

  Product name: Recombinant human C16orf74 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-76 aa of BC009078

  Sequence: GFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDPEA

• Full Name: chromosome 16 open reading frame 74
• Observed Molecular Weight: 15 - 20 kDa
• GenBank Accession Number: BC009078
• Gene Symbol: C16orf74
• Gene ID (NCBI): 404550
• RRID: AB_3086278
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GX8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The C16orf74 has been reported associated with tumor necrosis factor (TNF)-alpha as well as hypoxic condition. Moreover, several reports have indicated that C16orf74 expression is a potential prognostic factor in several types of cancer. The results of several genome-wide studies have indicated that C16orf74 is involved in inflammatory processes. C16orf74 is overexpressed in the vast majority of human PDAC(Clinical outcome of pancreatic ductal adenocarcinoma), and likely plays a significant role in pancreatic cell growth and invasion through its interaction with PPP3CA.