C17orf28 Polyclonal antibody

• 

  WB analysis of fetal human brain using 21174-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21174-1-AP (C17orf28 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 21174-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21174-1-AP (C17orf28 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 21174-1-AP

  IP result of anti-C17orf28 (IP:21174-1-AP, 3ug; Detection:21174-1-AP 1:500) with mouse brain tissue lysate 10000ug.

• 

  IHC staining of human stomach cancer using 21174-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21174-1-AP (C17orf28 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 21174-1-AP

  Immunofluorescent analysis of HepG2 cells, using C17orf28 antibody 21174-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of HeLa using 21174-1-AP

  Immunofluorescent analysis of Hela cells, using C17orf28 antibody 21174-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• Featured Product
• KD/KO Validated

C17orf28 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21174-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DMC1, Down-regulated in multiple cancers 1, HID1, HID1 domain-containing protein, Protein HID1

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 1 publications below

Product Information

21174-1-AP targets C17orf28 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15427

  Product name: Recombinant human C17orf28 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC035372

  Sequence: MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEDDEHARPLAESLLLAIADLLFCPDFTVQSHRRSTVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPAPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIVTLDHDSASSASPTVDGTTTGTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLS

• Full Name: chromosome 17 open reading frame 28
• Calculated Molecular Weight: 788 aa, 89 kDa
• Observed Molecular Weight: 60 kDa, 89 kDa
• GenBank Accession Number: BC035372
• Gene Symbol: C17orf28
• Gene ID (NCBI): 283987
• RRID: AB_10733124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IV36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Elife; HID-1 is required for homotypic fusion of immature secretory granules during maturation.; Authors - Wen Du ; KO Validated
rat	WB	Biophys Rep; PMID: 30596141; Authors - Min Li