C17orf28 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C17orf28 Polyclonal antibody (21174-1-AP)

• Featured Product
• KD/KO Validated

C17orf28 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21174-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DMC1, Down-regulated in multiple cancers 1, HID1, HID1 domain-containing protein, Protein HID1

• 

  WB analysis of fetal human brain using 21174-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21174-1-AP (C17orf28 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 21174-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21174-1-AP (C17orf28 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 21174-1-AP

  IP result of anti-C17orf28 (IP:21174-1-AP, 3ug; Detection:21174-1-AP 1:500) with mouse brain tissue lysate 10000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 21174-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21174-1-AP (C17orf28 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21174-1-AP

  Immunofluorescent analysis of HepG2 cells, using C17orf28 antibody 21174-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 21174-1-AP

  Immunofluorescent analysis of Hela cells, using C17orf28 antibody 21174-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C17orf28 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21174-1-AP targets C17orf28 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15427

  Product name: Recombinant human C17orf28 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC035372

  Sequence: MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVEKLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEDDEHARPLAESLLLAIADLLFCPDFTVQSHRRSTVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPAPESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIVTLDHDSASSASPTVDGTTTGTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLS

• Full Name: chromosome 17 open reading frame 28
• Calculated Molecular Weight: 788 aa, 89 kDa
• Observed Molecular Weight: 60 kDa, 89 kDa
• GenBank Accession Number: BC035372
• Gene Symbol: C17orf28
• Gene ID (NCBI): 283987
• RRID: AB_10733124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IV36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The C17orf28 Polyclonal antibody (Cat# 21174-1-AP) has 2 total citations. These appear in Biophysical Reports (2018) and eLife (2016). The research fields covered include proteomic analysis of insulin secretory granules and homotypic fusion of immature secretory granules during maturation, both related to vesicle trafficking and insulin secretion biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Elife; HID-1 is required for homotypic fusion of immature secretory granules during maturation.; Authors - Wen Du ; KO Validated
rat	WB	Biophys Rep; PMID: 30596141; Authors - Min Li