C17orf68 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84737-1-RR (same clone as 84737-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84737-1-RR (C17orf68 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84737-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 84737-1-RR (same clone as 84737-1-PBS)

  WB result of C17orf68 antibody (84737-1-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-C17orf68 transfected A549 cells. This data was developed using the same antibody clone with 84737-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

C17orf68 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84737-1-PBS

Clone No.241152C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

241152C6, AAF 132, CST complex subunit CTC1, CTC1, HBV DNAPTP1-transactivated protein B

---

Product Information

84737-1-PBS targets C17orf68 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28167

  Product name: Recombinant human C17orf68 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 337-566 aa of BC111783

  Sequence: PSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWAS

• Full Name: chromosome 17 open reading frame 68
• Calculated Molecular Weight: 1217 aa, 135 kDa
• Observed Molecular Weight: 140/145 kDa
• GenBank Accession Number: BC111783
• Gene Symbol: CTC1
• Gene ID (NCBI): 80169
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q2NKJ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Conserved telomere maintenance component 1 (CTC1) is a subunit of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase, the enzyme that initiates DNA replication (PMID: 19119139). CTC1 also functions in a telomere-associated complex with STN1 and TEN1 (PMID: 19854130).