MTNAP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MTNAP1 Polyclonal antibody (27762-1-AP)

MTNAP1 Polyclonal Antibody for WB, ELISA

Cat No. 27762-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C17orf80, Cell migration-inducing gene 3 protein, HLC 8, HLC-8, MIG3

• 

  WB analysis of HEK-293 using 27762-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27762-1-AP (C17orf80 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MTNAP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27762-1-AP targets MTNAP1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26903

  Product name: Recombinant human C17orf80 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-261 aa of BC005005

  Sequence: IPTDQKVYQSKPATLPRAKKMKGPIKDLIKAKGKELETENEERNSKLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNPSEAGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGV

• Full Name: chromosome 17 open reading frame 80
• Calculated Molecular Weight: 609 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC005005
• Gene Symbol: C17orf80
• Gene ID (NCBI): 55028
• RRID: AB_2880964
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSJ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MTNAP1 Polyclonal antibody (27762-1-AP) from Proteintech has 1 citation in total. The paper was published in the Journal of Cell Biology (J Cell Biol). The study, titled "C17orf80 binds the mitochondrial genome to promote its replication," focuses on the research field of mitochondrial biology/genome replication. The antibody was used in Western blot (WB) applications with human samples. The single citation confirms its utility in mitochondrial DNA replication research.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Biol; C17orf80 binds the mitochondrial genome to promote its replication; Authors - Hao Wu