C17orf81 Polyclonal antibody

• 

  WB analysis of HEK-293 using 10162-1-AP

  WB result of C17orf81 antibody (10162-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C17orf81 transfected HEK-293 cells.

• 

  WB analysis using 10162-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10162-1-AP (C17orf81 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 10162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10162-1-AP (C17orf81 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 10162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10162-1-AP (C17orf81 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 10162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10162-1-AP (C17orf81 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 10162-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10162-1-AP (C17orf81 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

C17orf81 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10162-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

MSTP071, MST071, HSPC002, ELP5, Elongator complex protein 5

---

Tested Applications

• Positive WB detected in: A375 cells, HEK-293 cells, K-562 cells
• Positive IHC detected in: mouse heart tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10162-1-AP targets C17orf81 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0194

  Product name: Recombinant human C17orf81 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-209 aa of BC002762

  Sequence: MTPSEGARAGTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRLVYHDFFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCTTLCQVLHAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGGTMGQASAHILCRRPRQR

• Full Name: chromosome 17 open reading frame 81
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 37 and 45 kDa
• GenBank Accession Number: BC002762
• Gene Symbol: C17orf81
• Gene ID (NCBI): 23587
• RRID: AB_2274975
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TE02
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELP5, also named as C17orf81, DERP6 and S-phase 2 protein, acts as subunit of the RNA polymerase II elongator complex. It's involved in TP53-mediated transcriptional regulation. ELP5 has some isoforms with MW 20 kDa, 30 kDa and 34-37 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cancer Res; Genome-Wide CRISPR Screens Identify Multiple Synthetic Lethal Targets That Enhance KRASG12C Inhibitor Efficacy; Authors - Suman Mukhopadhyay