C18orf32 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C18orf32 Polyclonal antibody, PBS Only (31237-1-PBS)

• 

  WB analysis using 31237-1-AP (same clone as 31237-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31237-1-AP (C18orf32 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31237-1-PBS in a different storage buffer formulation.

C18orf32 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31237-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31237-1-PBS targets C18orf32 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35313

  Product name: Recombinant human C18orf32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of NM_001199346.1

  Sequence: MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKD

• Full Name: chromosome 18 open reading frame 32
• Calculated Molecular Weight: 9kDa，76aa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: NM_001199346.1
• Gene Symbol: C18orf32
• Gene ID (NCBI): 497661
• RRID: AB_3669914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TCD1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.