C18orf34 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C18orf34 Polyclonal antibody, PBS Only (31148-1-PBS)

• 

  WB analysis using 31148-1-AP (same clone as 31148-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31148-1-AP (C18orf34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31148-1-PBS in a different storage buffer formulation.

C18orf34 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31148-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31148-1-PBS targets C18orf34 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33847

  Product name: Recombinant human C18orf34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC130535

  Sequence: MTENKTVSSSSTRDDQTNIGLTCQEVKALREKAWSRTNEGNAMSQSLVLYGASKENSEGFHESKMTNTEGVNKGIYFSYPCRRHSCAVVNIPAPCVNKMISHIQDVESKIQEHLKRFETSFEEWSRTSSTKDLKEDWSVTTPVKEVKPGEKRDEKCPELKQEMETLLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQELQDLKNHYKKKMEVMDLHRKVNEELEEALEACENARLKAQQIKEEIDKDIYQDEKTIEAYKREIYQLNSL

• Full Name: chromosome 18 open reading frame 34
• Observed Molecular Weight: 95-102 kDa
• GenBank Accession Number: BC130535
• Gene Symbol: C18orf34
• Gene ID (NCBI): 374864
• RRID: AB_3669871
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5BJE1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.